Recombinant Human CCL25 protein, GST-tagged

• Cat.No.: CCL25-2654H
• Product Overview: Recombinant Human CCL25 protein(O15444)(24-150aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 24-150aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 41.2 kDa
• AA Sequence: QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CCL25 chemokine (C-C motif) ligand 25 [ Homo sapiens ]
• Official Symbol: CCL25
• Synonyms: CCL25; chemokine (C-C motif) ligand 25; SCYA25, small inducible cytokine subfamily A (Cys Cys), member 25; C-C motif chemokine 25; Ck beta 15; Ckb15; TECK; TECKvar; thymus expressed chemokine; Ck beta-15; chemokine TECK; thymus-expressed chemokine; small-inducible cytokine A25; small inducible cytokine subfamily A (Cys-Cys), member 25; SCYA25; MGC150327
• Gene ID: 6370
• mRNA Refseq: NM_001201359
• Protein Refseq: NP_001188288
• MIM: 602565
• UniProt ID: O15444