Recombinant Human CCL25 protein

Description :	CCL25 is new member of CC family chemokine. It is also called Thymus-expressed chemokine (TECK) because it is restricted produced by thymus and intestine. Especially, the dendritic cells derived from thymus but not bone marrow had identified to be the source of CCL25. By binding with CCR9, it elicits its effects of chemotactic for thymocytes, macrophages, and dendritic cells. Additionally, CCL25 takes part in regulating the development of T-cells.
Source :	E.coli
Species :	Human
Form :	Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
Bio-activity :	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 1.0-10 ng/ml.
Molecular Mass :	Approximately 14.3 kDa, a single, non-glycosylated polypeptide chain containing 128 amino acids.
Protein length :	128
AA Sequence :	MQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Endotoxin :	Less than 1 EU/µg of rHuTECK/CCL25 as determined by LAL method.
Purity :	>97% by SDS-PAGE and HPLC analysis.
Storage :	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Tag :	Non

Gene Name	CCL25
Official Symbol	CCL25
Synonyms	CCL25; chemokine (C-C motif) ligand 25; SCYA25, small inducible cytokine subfamily A (Cys Cys), member 25; C-C motif chemokine 25; Ck beta 15; Ckb15; TECK; TECKvar; thymus expressed chemokine; Ck beta-15; chemokine TECK; thymus-expressed chemokine; small-inducible cytokine A25; small inducible cytokine subfamily A (Cys-Cys), member 25; SCYA25; MGC150327;
Gene ID	6370
mRNA Refseq	NM_001201359
Protein Refseq	NP_001188288
MIM	602565
UniProt ID	O15444