Recombinant Human CCL24 Protein

• Cat.No.: CCL24-51H
• Product Overview: Recombinant Human CCL24 Protein was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 78 amino acid
• Description: Recombinant human CCL24 1-78 is secreted from cells after cleavage of the signal peptide as originally described by Forssmann et al. Human CCL24, also designated eotaxin-2 and Macrophage inflammatory protein 3 (MIP-2), attracts eosinophils and resting T cells through activation of the G protein-coupled receptor CCR3.
• Form: Lyophilized
• Molecular Mass: 8.83441 kDa
• AA Sequence: VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQR YMKNLDAKQKKASPRARAVA
• Endotoxin: Endotoxin-free <0.01 EU/ug
• Purity: Purity assessed by HPLC, Mass Spectrometry, and NMR
• Storage: Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
• tmpcolum67: C-C motif chemokine ligand 24

Gene Information

• Gene Name: CCL24 C-C motif chemokine ligand 24 [ Homo sapiens (human) ]
• Official Symbol: CCL24
• Synonyms: Ckb-6; MPIF2; MPIF-2; SCYA24
• Gene ID: 6369
• mRNA Refseq: NM_002991
• Protein Refseq: NP_002982
• MIM: 602495
• UniProt ID: O00175