Recombinant Human CCL24 Protein

Cat.No. : CCL24-51H
Product Overview : Recombinant Human CCL24 Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 78 amino acid
Description : Recombinant human CCL24 1-78 is secreted from cells after cleavage of the signal peptide as originally described by Forssmann et al. Human CCL24, also designated eotaxin-2 and Macrophage inflammatory protein 3 (MIP-2), attracts eosinophils and resting T cells through activation of the G protein-coupled receptor CCR3.
Form : Lyophilized
Molecular Mass : 8.83441 kDa
AA Sequence : VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQR YMKNLDAKQKKASPRARAVA
Endotoxin : Endotoxin-free <0.01 EU/ug
Purity : Purity assessed by HPLC, Mass Spectrometry, and NMR
Storage : Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
tmpcolum67 : C-C motif chemokine ligand 24
Gene Name CCL24 C-C motif chemokine ligand 24 [ Homo sapiens (human) ]
Official Symbol CCL24
Synonyms Ckb-6; MPIF2; MPIF-2; SCYA24
Gene ID 6369
mRNA Refseq NM_002991
Protein Refseq NP_002982
MIM 602495
UniProt ID O00175

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCL24 Products

Required fields are marked with *

My Review for All CCL24 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon