Recombinant Human CCL24 Protein
Cat.No. : | CCL24-51H |
Product Overview : | Recombinant Human CCL24 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Recombinant human CCL24 1-78 is secreted from cells after cleavage of the signal peptide as originally described by Forssmann et al. Human CCL24, also designated eotaxin-2 and Macrophage inflammatory protein 3 (MIP-2), attracts eosinophils and resting T cells through activation of the G protein-coupled receptor CCR3. |
Source : | E. coli |
Species : | Human |
Form : | Lyophilized |
Molecular Mass : | 8.83441 kDa |
Protein length : | 78 amino acid |
AA Sequence : | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQR YMKNLDAKQKKASPRARAVA |
Endotoxin : | Endotoxin-free <0.01 EU/ug |
Purity : | Purity assessed by HPLC, Mass Spectrometry, and NMR |
Storage : | Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month. |
tmpcolum67 : | C-C motif chemokine ligand 24 |
Gene Name | CCL24 C-C motif chemokine ligand 24 [ Homo sapiens (human) ] |
Official Symbol | CCL24 |
Synonyms | Ckb-6; MPIF2; MPIF-2; SCYA24 |
Gene ID | 6369 |
mRNA Refseq | NM_002991 |
Protein Refseq | NP_002982 |
MIM | 602495 |
UniProt ID | O00175 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CCL24 Products
Required fields are marked with *
My Review for All CCL24 Products
Required fields are marked with *
0
Inquiry Basket