Recombinant Human CCL14 Protein, Biotinylated

• Cat.No.: CCL14-012H
• Product Overview: Biotinylated Recombinant human CCL14 protein was tag free expressed.

Specification

• Description: This gene, chemokine (C-C motif) ligand 14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene, chemokine (C-C motif) ligand 15, and are represented as GeneID: 348249.
• Species: Human
• Form: Lyophilized
• Protein length: 93
• AA Sequence: MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
• Purity: > 97%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered and lyophilized.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: CCL14 chemokine (C-C motif) ligand 14 [ Homo sapiens (human) ]
• Official Symbol: CCL14
• Synonyms: CCL14; chemokine (C-C motif) ligand 14; SCYA14, small inducible cytokine subfamily A (Cys Cys), member 14; C-C motif chemokine 14; CKb1; HCC 1; HCC 3; MCIF; NCC 2; SCYL2; chemokine CC-3; new CC chemokine 2; chemokine CC-1/CC-3; hemofiltrate CC chemokine 1; small-inducible cytokine A14; small inducible cytokine subfamily A (Cys-Cys), member 14; CC-1; CC-3; CKB1; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYA14; HCC-1(1-74); HCC-1/HCC-3; FLJ16015
• Gene ID: 6358
• mRNA Refseq: NM_032962
• Protein Refseq: NP_116738
• MIM: 601392
• UniProt ID: Q16627