Recombinant Human CCL14 protein

• Cat.No.: CCL14-0608H
• Product Overview: Recombinant Human CCL14 protein (72 a.a.) was expressed in Escherichia coli.

Specification

• Description: Human CCL14 is belonging to the CC chemokine family. It has two isoforms, CCL14a (HCC-1) and CCL14b (HCC-3). The sequence of HCC-3 differs from HCC-1 as follow: 27-27 R→ QTGGKPKVVKIQLKLVG. CCL14 was first isolated from the hemofiltrate of human patients with chronic renal failure. CCL14 promotes chemotaxis of T lymphocytes, monocytes and eosinophils, and inhibits infection of M-tropic human immunodeficiency virus type 1 and is a ligand for CCR1, CCR3 and CCR5. CCL14 is expressed constitutively in several normal tissues: spleen, liver, skeletal and heart muscle, gut, and bone marrow, present at high concentrations in plasma.
• Source: E.coli
• Species: Human
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl.
• Bio-activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration of 5.0-20 ng/ml.
• Molecular Mass: Approximately 8.4 kDa, a single non-glycosylated polypeptide chain containing 72 amino acids.
• Protein length: 72
• AA Sequence: TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
• Endotoxin: Less than 1 EU/μg of rHuHCC-1/CCL14 as determined by LAL method.
• Purity: >96% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: CCL14
• Official Symbol: CCL14
• Synonyms: CCL14; chemokine (C-C motif) ligand 14; SCYA14, small inducible cytokine subfamily A (Cys Cys), member 14; C-C motif chemokine 14; CKb1; HCC 1; HCC 3; MCIF; NCC 2; SCYL2; chemokine CC-3; new CC chemokine 2; chemokine CC-1/CC-3; hemofiltrate CC chemokine 1; small-inducible cytokine A14; small inducible cytokine subfamily A (Cys-Cys), member 14; CC-1; CC-3; CKB1; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYA14; HCC-1(1-74); HCC-1/HCC-3; FLJ16015
• Gene ID: 6358
• mRNA Refseq: NM_032962
• Protein Refseq: NP_116738
• MIM: 601392
• UniProt ID: Q16627