Recombinant Human CCL14 protein
Cat.No. : | CCL14-607H |
Product Overview : | Recombinant Human CCL14 protein (66 a.a.) was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 66 |
Description : | Human CCL14 is belonging to the CC chemokine family. It is encoded by the gene CCL14. CCL14 has two isoforms, CCL14a (HCC-1) and CCL14b (HCC-3). The sequence of HCC-3 differs from HCC-1 as follow: 27-27 R→ QTGGKPKVVKIQLKLVG. CCL14 was first isolated from the hemofiltrate of human patients with chronic renal failure. The N-terminal processed forms HCC-1(3-74), HCC-1(4-74) and HCC-1(9-74) are produced in small amounts by proteolytic cleavage after secretion in blood. CCL14 promotes chemotaxis of T lymphocytes, monocytes and eosinophils, and inhibits infection of M-tropic human immunodeficiency virus type 1 and is a ligand for CCR1, CCR3 and CCR5. Recombinant human CCL14 (66 a.a.) contains 66 amino acid residues and activation of the HCC 1/CCL14a precursor to active peptide is mediated by the urokinase type plasminogen activator or plasmin. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4, 5 % trehalose. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration range of 5.0-20 ng/ml. |
Molecular Mass : | Approximately 7.8 kDa, a single non-glycosylated polypeptide chain containing 66 amino acids. |
AA Sequence : | GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
Endotoxin : | Less than 1 EU/μg of rHuHCC-1, 66a.a./CCL14 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL14 |
Official Symbol | CCL14 |
Synonyms | CCL14; chemokine (C-C motif) ligand 14; SCYA14, small inducible cytokine subfamily A (Cys Cys), member 14; C-C motif chemokine 14; CKb1; HCC 1; HCC 3; MCIF; NCC 2; SCYL2; chemokine CC-3; new CC chemokine 2; chemokine CC-1/CC-3; hemofiltrate CC chemokine 1; small-inducible cytokine A14; small inducible cytokine subfamily A (Cys-Cys), member 14; CC-1; CC-3; CKB1; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYA14; HCC-1(1-74); HCC-1/HCC-3; FLJ16015; |
Gene ID | 6358 |
mRNA Refseq | NM_032962 |
Protein Refseq | NP_116738 |
MIM | 601392 |
UniProt ID | Q16627 |
◆ Recombinant Proteins | ||
CCL14-10836H | Recombinant Human CCL14, GST-tagged | +Inquiry |
CCL14-1067H | Recombinant Human CCL14 protein(Gly28-Asn93), His-tagged | +Inquiry |
CCL14-151H | Recombinant Human CCL14 Protein, His-tagged | +Inquiry |
CCL14-335H | Active Recombinant Human Chemokine (C-C Motif) Ligand 14, HIgG1 Fc-tagged | +Inquiry |
CCL14-1901H | Recombinant Human CCL14 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL14-7732HCL | Recombinant Human CCL14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL14 Products
Required fields are marked with *
My Review for All CCL14 Products
Required fields are marked with *
0
Inquiry Basket