Active Recombinant Human CCL14 Protein (72 aa)

Cat.No. : CCL14-384C
Product Overview : Recombinant human Hemofiltrate CC Chemokine-1 (HCC-1)/CCL14 (rhHCC-1) produced in E. coli is a single non-glycosylated polypeptide chain containing 72 amino acids. A fully biologically active molecule, rhHCC-1 has a molecular mass of 8.4kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 72
Description : HCC-1/CCL14 is a member of the chemokine family, which are small chemotactic proteins that regulate cell migration under inflammatory and steady state conditions. HCC-1 is expressed in epithelial and decidual cells and is unique among chemokines due to its high abundance in normal human plasma. HCC-1 can bind to chemokine receptors CCR1 and CCR5, however full length HCC-1 is a weak agonist of CCR1 and only becomes potent after removal of its eight N-terminal residues. Chemokine decoy receptor D6 can bind HCC-1 and promote its degradation as a means to regulate its level in vivo. Functionally HCC-1 promotes trophoblast migration by regulating extracellular matrix components as well as specific adhesion molecules.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 25 μg/mL, measured by the FLIPR assay using CHO cells transfected with human CCR5, the receptor of human CCL14, corresponding to a specific activity of > 40 units/mg.
Molecular Mass : 8.4 kDa, observed by reducing SDS-PAGE.
AA Sequence : TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE analysis.
Storage : Lyophilized recombinant human Hemofiltrate CC Chemokine-1 (72 a.a.) (HCC-1)/CCL14 (rhHCC-1) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhHCC-1 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name CCL14 chemokine (C-C motif) ligand 14 [ Homo sapiens ]
Official Symbol CCL14
Synonyms CCL14; chemokine (C-C motif) ligand 14; SCYA14, small inducible cytokine subfamily A (Cys Cys), member 14; C-C motif chemokine 14; CKb1; HCC 1; HCC 3; MCIF; NCC 2; SCYL2; chemokine CC-3; new CC chemokine 2; chemokine CC-1/CC-3; hemofiltrate CC chemokine 1; small-inducible cytokine A14; small inducible cytokine subfamily A (Cys-Cys), member 14; CC-1; CC-3; CKB1; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYA14; HCC-1(1-74); HCC-1/HCC-3; FLJ16015;
Gene ID 6358
mRNA Refseq NM_032962
Protein Refseq NP_116738
MIM 601392
UniProt ID Q16627

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCL14 Products

Required fields are marked with *

My Review for All CCL14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon