Recombinant Human CCKBR protein

• Cat.No.: CCKBR-25H
• Product Overview: Recombinant Human CCKBR was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCKanalogs and is found principally in the central nervous system and the gastrointestinal tract. A misspliced transcript variant including an intron has been observed in cells from colorectal and pancreatic tumors.
• Form: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Molecular Mass: 48.4 kDa
• AA Sequence: MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITLYAVIFLMSVGGNMLI IVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIAL ERYSAICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLL LFFIPGVVMAVAYGLISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS RPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFI HLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGPG
• Applications: Antibody Production;Functional Study: Recommended usage only, not validated yet.Compound Screening: Recommended usage only, not validated yet.
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: CCKBR cholecystokinin B receptor [ Homo sapiens ]
• Official Symbol: CCKBR
• Synonyms: CCKBR; cholecystokinin B receptor; gastrin/cholecystokinin type B receptor; CCK-BR; CCK2-R; CCK2 receptor; CCK-B receptor; gastrin receptor; cholecystokinin-2 receptor; GASR; CCK-B; CCK2R
• Gene ID: 887
• mRNA Refseq: NM_176875
• Protein Refseq: NP_795344
• MIM: 118445
• UniProt ID: P32239
• Chromosome Location: 11p15.4
• Pathway: Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem
• Function: 1-phosphatidylinositol-3-kinase regulator activity; G-protein coupled receptor activity; cholecystokinin receptor activity; gastrin receptor activity; phosphatidylinositol phospholipase C activity; receptor activity; signal transducer activity; type B gastrin/cholecystokinin receptor binding