Recombinant Human CCDC86 Protein, GST-Tagged

• Cat.No.: CCDC86-0587H
• Product Overview: Human CCDC86 full-length ORF (NP_077003.1, 1 a.a. - 360 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CCDC86 (Coiled-Coil Domain Containing 86) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding.
• Molecular Mass: 66.6 kDa
• AA Sequence: MDTPLRRSRRLGGLRPESPESLTSVSRTRRALVEFESNPEETREPGSPPSVQRAGLGSPERPPKTSPGSPRLQQGAGLESPQGQPEPGAASPQRQQDLHLESPQRQPEYSPESPRCQPKPSEEAPKCSQDQGVLASELAQNKEELTPGAPQHQLPPVPGSPEPYPGQQAPGPEPSQPLLELTPRAPGSPRGQHEPSKPPPAGETVTGGFGAKKRKGSSSQAPASKKLNKEELPVIPKGKPKSGRVWKDRSKKRFSQMLQDKPLRTSWQRKMKERQERKLAKDFARHLEEEKERRRQEKKQRRAENLKRRLENERKAEVVQVIRNPAKLKRAKKKQLRSIEKRDTLALLQKQPPQQPAAKI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC86 coiled-coil domain containing 86 [ Homo sapiens ]
• Official Symbol: CCDC86
• Synonyms: CCDC86; coiled-coil domain containing 86; coiled-coil domain-containing protein 86; MGC2574; cyclon; cytokine-induced protein with coiled-coil domain; FLJ22321
• Gene ID: 79080
• mRNA Refseq: NM_024098
• Protein Refseq: NP_077003
• MIM: 611293
• UniProt ID: Q9H6F5