Recombinant Human CCDC85B Protein, GST-tagged

Cat.No. : CCDC85B-2633H
Product Overview : Human DIPA partial ORF ( NP_006839.2, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Hepatitis delta virus (HDV) is a pathogenic human virus whose RNA genome and replication cycle resemble those of plant viroids. Delta-interacting protein A (DIPA), a cellular gene product, has been found to have homology to hepatitis delta virus antigen (HDAg). DIPA interacts with the viral antigen, HDAg, and can affect HDV replication in vitro. [provided by RefSeq, Jul 2008]
Molecular Mass : 37.84 kDa
AA Sequence : MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC85B coiled-coil domain containing 85B [ Homo sapiens ]
Official Symbol CCDC85B
Synonyms CCDC85B; coiled-coil domain containing 85B; coiled-coil domain-containing protein 85B; DIPA; hepatitis delta antigen interacting protein A; delta-interacting protein A; hepatitis delta antigen-interacting protein A;
Gene ID 11007
mRNA Refseq NM_006848
Protein Refseq NP_006839
MIM 605360
UniProt ID Q15834

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCDC85B Products

Required fields are marked with *

My Review for All CCDC85B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon