Recombinant Human CCDC85B Protein, GST-tagged

• Cat.No.: CCDC85B-2633H
• Product Overview: Human DIPA partial ORF ( NP_006839.2, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Hepatitis delta virus (HDV) is a pathogenic human virus whose RNA genome and replication cycle resemble those of plant viroids. Delta-interacting protein A (DIPA), a cellular gene product, has been found to have homology to hepatitis delta virus antigen (HDAg). DIPA interacts with the viral antigen, HDAg, and can affect HDV replication in vitro. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.84 kDa
• AA Sequence: MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC85B coiled-coil domain containing 85B [ Homo sapiens ]
• Official Symbol: CCDC85B
• Synonyms: CCDC85B; coiled-coil domain containing 85B; coiled-coil domain-containing protein 85B; DIPA; hepatitis delta antigen interacting protein A; delta-interacting protein A; hepatitis delta antigen-interacting protein A
• Gene ID: 11007
• mRNA Refseq: NM_006848
• Protein Refseq: NP_006839
• MIM: 605360
• UniProt ID: Q15834