Recombinant Human CCDC169 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CCDC169-4635H
• Product Overview: C13orf38 MS Standard C13 and N15-labeled recombinant protein (NP_001138453) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: CCDC169 (Coiled-Coil Domain Containing 169) is a Protein Coding gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 25.1 kDa
• AA Sequence: MKEERNYNFDGVSTNRLKQQLLEEVRKKDAVQLSIFELRHKITELEAKLNTDNEGSEWKTRYETQLELNDELEKQIVYLKEKVEKIHGNSSDRLSSIRVYERMPVESLNTLLKQLEEEKKTLESQVKYYALKLEQESKAYQKINNERRTYLAEMSQGSGLHQVSKRQQVDQLPRMQENLVKTGRYNPAKQKTVSAKRGPVKKITRPNHLPELHPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CCDC169 coiled-coil domain containing 169 [ Homo sapiens (human) ]
• Official Symbol: CCDC169
• Synonyms: CCDC169; coiled-coil domain containing 169; C13orf38, chromosome 13 open reading frame 38; coiled-coil domain-containing protein 169; LOC728591; RP11 251J8.1; RP11-251J8.1; C13orf38; FLJ13506; FLJ29024; FLJ57222
• Gene ID: 728591
• mRNA Refseq: NM_001144981
• Protein Refseq: NP_001138453
• UniProt ID: A6NNP5