Recombinant Human CCDC148 Protein, GST-Tagged

Cat.No. : CCDC148-0531H
Product Overview : Human CCDC148 full-length ORF (AAH15395.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CCDC148 (Coiled-Coil Domain Containing 148) is a Protein Coding gene.
Molecular Mass : 56.7 kDa
AA Sequence : MCAASASPDNLVFHMKNEMRNIKYKPVDYQQLRALTEAKKLASASAKLKIRKAMLTSKLSKEQTLIKQHKQVWWQEYQRLNEVRCKMESEIKSLLNEENIGNECLCDLTNFEQELSEQQCTYLKNVINPIQQLRADLKYRQHHTLQHSHPHIEFNSVKVLEEVDFVKKQLKTVFERLRLEQQRIENDLSDWSIKILDHSLEEKTNPLSELPIELESLECPYPDLKSSILSEFYKFTQKYQKKLQDFNLQLEDIYR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC148 coiled-coil domain containing 148 [ Homo sapiens ]
Official Symbol CCDC148
Synonyms CCDC148; coiled-coil domain containing 148; coiled-coil domain-containing protein 148; MGC125588; MGC125590;
Gene ID 130940
mRNA Refseq NM_001171637
Protein Refseq NP_001165108
UniProt ID Q8NFR7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCDC148 Products

Required fields are marked with *

My Review for All CCDC148 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon