Recombinant Human CCDC144NL Protein, GST-tagged

• Cat.No.: CCDC144NL-5300H
• Product Overview: Human MGC87631 full-length ORF ( NP_001004306.1, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CCDC144NL (Coiled-Coil Domain Containing 144 Family, N-Terminal Like) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 50.2 kDa
• AA Sequence: MASWGGEKRGGAGGSPKPAVYATRKTPSVGSQEDQWYLDYPGDQWSLGFSYSWWKNSVGSESKHGEGALDQLQHDVRLEDLGELHRAARSGDVPGVEHVLAPGDTGVDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPAAPSQAEGGEGGVACGTVEQMTWLCSLPHAVGGGDGDHSSTGAVGGHPRGPGEYCHLHEQRVHHHIFARGKRKGKNHVSNVVR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC144NL coiled-coil domain containing 144 family, N-terminal like [ Homo sapiens (human) ]
• Official Symbol: CCDC144NL
• Synonyms: CCDC144NL; coiled-coil domain containing 144 family, N-terminal like; putative coiled-coil domain-containing protein 144 N-terminal-like
• Gene ID: 339184
• mRNA Refseq: NM_001004306
• Protein Refseq: NP_001004306
• UniProt ID: Q6NUI1