Recombinant Human CCDC144NL Protein, GST-tagged
Cat.No. : | CCDC144NL-5300H |
Product Overview : | Human MGC87631 full-length ORF ( NP_001004306.1, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CCDC144NL (Coiled-Coil Domain Containing 144 Family, N-Terminal Like) is a Protein Coding gene. |
Molecular Mass : | 50.2 kDa |
AA Sequence : | MASWGGEKRGGAGGSPKPAVYATRKTPSVGSQEDQWYLDYPGDQWSLGFSYSWWKNSVGSESKHGEGALDQLQHDVRLEDLGELHRAARSGDVPGVEHVLAPGDTGVDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPAAPSQAEGGEGGVACGTVEQMTWLCSLPHAVGGGDGDHSSTGAVGGHPRGPGEYCHLHEQRVHHHIFARGKRKGKNHVSNVVR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC144NL coiled-coil domain containing 144 family, N-terminal like [ Homo sapiens (human) ] |
Official Symbol | CCDC144NL |
Synonyms | CCDC144NL; coiled-coil domain containing 144 family, N-terminal like; putative coiled-coil domain-containing protein 144 N-terminal-like |
Gene ID | 339184 |
mRNA Refseq | NM_001004306 |
Protein Refseq | NP_001004306 |
UniProt ID | Q6NUI1 |
◆ Recombinant Proteins | ||
CCDC144NL-5300H | Recombinant Human CCDC144NL Protein, GST-tagged | +Inquiry |
CCDC144NL-6445HF | Recombinant Full Length Human CCDC144NL Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC144NL-7776HCL | Recombinant Human CCDC144NL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCDC144NL Products
Required fields are marked with *
My Review for All CCDC144NL Products
Required fields are marked with *
0
Inquiry Basket