Recombinant Human CCDC134 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CCDC134-1350H
• Product Overview: CCDC134 MS Standard C13 and N15-labeled recombinant protein (NP_079097) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: CCDC134 (Coiled-Coil Domain Containing 134) is a Protein Coding gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 26.6 kDa
• AA Sequence: MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CCDC134 coiled-coil domain containing 134 [ Homo sapiens (human) ]
• Official Symbol: CCDC134
• Synonyms: CCDC134; coiled-coil domain containing 134; dJ821D11.3; coiled-coil domain-containing protein 134
• Gene ID: 79879
• mRNA Refseq: NM_024821
• Protein Refseq: NP_079097
• MIM: 618788
• UniProt ID: Q9H6E4