Recombinant Human CCDC130 Protein, GST-Tagged

• Cat.No.: CCDC130-0523H
• Product Overview: Human CCDC130 full-length ORF (NP_110445.1, 1 a.a. - 396 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CCDC130 (Coiled-Coil Domain Containing 130) is a Protein Coding gene. Diseases associated with CCDC130 include Trench Fever and Phlebotomus Fever. Among its related pathways are Ectoderm Differentiation. An important paralog of this gene is CCDC94.
• Molecular Mass: 71.2 kDa
• AA Sequence: MGERKGVNKYYPPDFNPEKHGSLNRYHNSHPLRERARKLSQGILIIRFEMPYNIWCDGCKNHIGMGVRYNAEKKKVGNYYTTPIYRFRMKCHLCVNYIEMQTDPANCDYVIVSGAQRKEERWDMADNEQVLTTEHEKKQKLETDAMFRLEHGEADRSTLKKALPTLSHIQEAQSAWKDDFALNSMLRRRFREKKKAIQEEEERDQALQAKASLTIPLVPETEDDRKLAALLKFHTLDSYEDKQKLKRTEIISRSWFPSAPGSASSSKVSGVLKKLAQSRRTALATSPITVGDLGIVRRRSRDVPESPQHAADTPKSGEPRVPEEAAQDRPMSPGDCPPETTETPKCSSPRGQEGSRQDKPLSPAGSSQEAADTPDTRHPCSLGSSLVADYSDSESE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC130 coiled-coil domain containing 130 [ Homo sapiens ]
• Official Symbol: CCDC130
• Synonyms: coiled-coil domain containing 130; 9 kDa protein; MGC10471; coiled-coil domain-containing protein 130
• Gene ID: 81576
• mRNA Refseq: NM_030818
• Protein Refseq: NP_110445
• UniProt ID: P13994