Recombinant Human CCDC126 Protein, GST-Tagged

• Cat.No.: CCDC126-0521H
• Product Overview: Human CCDC126 full-length ORF (NP_620126.2, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CCDC126 (Coiled-Coil Domain Containing 126) is a Protein Coding gene. GO annotations related to this gene include alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity. An important paralog of this gene is MGAT5B.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 42.1 kDa
• AA Sequence: MFFTISRKNMSQKLSLLLLVFGLIWGLMLLHYTFQQPRHQSSVKLREQILDLSKRYVKALAEENKNTVDVENGASMAGYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGSAANTTNGTSGNLVPVTTNKRTNVSGSIR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC126 coiled-coil domain containing 126 [ Homo sapiens ]
• Official Symbol: CCDC126
• Synonyms: CCDC126; coiled-coil domain containing 126; coiled-coil domain-containing protein 126; FLJ23031; MGC104248
• Gene ID: 90693
• mRNA Refseq: NM_138771
• Protein Refseq: NP_620126
• UniProt ID: Q96EE4