Recombinant Human CCDC121 Protein, GST-tagged

• Cat.No.: CCDC121-5185H
• Product Overview: Human CCDC121 full-length ORF ( NP_078860.2, 1 a.a. - 278 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CCDC121 (Coiled-Coil Domain Containing 121) is a Protein Coding gene.
• Molecular Mass: 59.5 kDa
• AA Sequence: MTDLNKHIKQAQTQRKQLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSGEIERRRQESASRYAEQISVLKTALLQKENIQSSLKRKLQAMRDIAILKEKQEKEIQTLQEETKKVQAETASKTREVQAQLLQEKRLLEKQLSEPDRRLLGKRKRRELNMKAQALKLAAKRFIFEYSCGINRENQQFKKELLQLIEQAQKLTATQSHLENRKQQLQQEQWYLESLIQARQRLQGSHNQCLNRQDVPKTTPSLPQGTKSRINPK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC121 coiled-coil domain containing 121 [ Homo sapiens (human) ]
• Official Symbol: CCDC121
• Synonyms: CCDC121; coiled-coil domain containing 121; coiled-coil domain-containing protein 121
• Gene ID: 79635
• mRNA Refseq: NM_001142683
• Protein Refseq: NP_001136155
• UniProt ID: Q6ZUS5