Recombinant Human CCDC12 Protein, GST-Tagged

Cat.No. : CCDC12-0517H
Product Overview : Human CCDC12 full-length ORF (NP_653317.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CCDC12 (Coiled-Coil Domain Containing 12) is a Protein Coding gene. Among its related pathways are mRNA Splicing - Major Pathway.
Molecular Mass : 45.6 kDa
AA Sequence : MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC12 coiled-coil domain containing 12 [ Homo sapiens ]
Official Symbol CCDC12
Synonyms CCDC12; coiled-coil domain containing 12; coiled-coil domain-containing protein 12; MGC23918; FLJ39430; FLJ40801;
Gene ID 151903
mRNA Refseq NM_144716
Protein Refseq NP_653317
UniProt ID Q8WUD4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCDC12 Products

Required fields are marked with *

My Review for All CCDC12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon