Recombinant Human CCDC117 Protein, GST-Tagged

Cat.No. : CCDC117-0516H
Product Overview : Human CCDC117 full-length ORF (CAK54443.1, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : CCDC117 (Coiled-Coil Domain Containing 117) is a Protein Coding gene.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 45.1 kDa
AA Sequence : MAALGRPFSGLSIPGILDVICEEMDQTTGEPQCEVARRKLQEIEDRIIDEDEEVEADRNVNHLPSLVLSDTMKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNTKNYTGESQAKHVAAGTAFPQRTELFSEPRPTGMSLYNSLETATSTEEEMEL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCDC117 coiled-coil domain containing 117 [ Homo sapiens ]
Official Symbol CCDC117
Synonyms CCDC117; coiled-coil domain containing 117; coiled-coil domain-containing protein 117; FLJ33814; dJ366L4.1;
Gene ID 150275
mRNA Refseq NM_173510
Protein Refseq NP_775781
UniProt ID Q8IWD4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCDC117 Products

Required fields are marked with *

My Review for All CCDC117 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon