Recombinant Full Length Human CCDC117 Protein, GST-tagged

• Cat.No.: CCDC117-2829HF
• Product Overview: Human CCDC117 full-length ORF (CAK54443.1, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CCDC117 (Coiled-Coil Domain Containing 117) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 45.1 kDa
• Protein length: 170 amino acids
• AA Sequence: MAALGRPFSGLSIPGILDVICEEMDQTTGEPQCEVARRKLQEIEDRIIDEDEEVEADRNVNHLPSLVLSDTMKTGLKREFDEVFTKKMIESMSRPSMELVLWKPLPELLSDKPKPSSNTKNYTGESQAKHVAAGTAFPQRTELFSEPRPTGMSLYNSLETATSTEEEMEL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC117 coiled-coil domain containing 117 [ Homo sapiens ]
• Official Symbol: CCDC117
• Synonyms: CCDC117; coiled-coil domain containing 117; coiled-coil domain-containing protein 117; FLJ33814; dJ366L4.1
• Gene ID: 150275
• mRNA Refseq: NM_173510
• Protein Refseq: NP_775781
• UniProt ID: Q8IWD4