Recombinant Human CCDC112 protein, His-tagged

• Cat.No.: CCDC112-91H
• Product Overview: Recombinant Human CCDC112 protein(Q8NEF3)(73-227aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 73-227aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 24.3 kDa
• AA Sequence: REMMEEIENAINTFKEEQRLIYEELIKEEKTTNNELSAISRKIDTWALGNSETEKAFRAISSKVPVDKVTPSTLPEEVLDFEKFLQQTGGRQGAWDDYDHQNFVKVRNKHKGKPTFMEEVLEHLPGKTQDEVQQHEKWYQKFLALEERKKESIQI
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CCDC112 coiled-coil domain containing 112 [ Homo sapiens ]
• Official Symbol: CCDC112
• Synonyms: CCDC112; coiled-coil domain containing 112; coiled-coil domain-containing protein 112; MGC39633; mutated in bladder cancer 1; mutated in bladder cancer protein 1; MBC1
• Gene ID: 153733
• mRNA Refseq: NM_001040440
• Protein Refseq: NP_001035530
• UniProt ID: Q8NEF3