Recombinant Human CBX7 Protein, GST-Tagged

• Cat.No.: CBX7-0485H
• Product Overview: Human CBX7 full-length ORF (NP_783640.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein that contains the CHROMO (CHRomatin Organization MOdifier) domain. The encoded protein is a component of the Polycomb repressive complex 1 (PRC1), and is thought to control the lifespan of several normal human cells. [provided by RefSeq, Oct 2016]
• Molecular Mass: 54.7 kDa
• AA Sequence: MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CBX7 chromobox homolog 7 [ Homo sapiens ]
• Official Symbol: CBX7
• Synonyms: CBX7; chromobox homolog 7; chromobox protein homolog 7
• Gene ID: 23492
• mRNA Refseq: NM_175709
• Protein Refseq: NP_783640
• MIM: 608457
• UniProt ID: O95931