Recombinant Human CBR1 protein, GST-tagged

• Cat.No.: CBR1-2642H
• Product Overview: Recombinant Human CBR1 protein(P16152)(2-277aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 2-277aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 57.2 kDa
• AA Sequence: SSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CBR1 carbonyl reductase 1 [ Homo sapiens ]
• Official Symbol: CBR1
• Synonyms: CBR1; carbonyl reductase 1; CBR; carbonyl reductase [NADPH] 1; SDR21C1; short chain dehydrogenase/reductase family 21C; member 1; carbonyl reductase (NADPH) 1; prostaglandin 9-ketoreductase; prostaglandin-E(2) 9-reductase; NADPH-dependent carbonyl reductase 1; 15-hydroxyprostaglandin dehydrogenase; short chain dehydrogenase/reductase family 21C, member 1; hCBR1
• Gene ID: 873
• mRNA Refseq: NM_001757
• Protein Refseq: NP_001748
• MIM: 114830
• UniProt ID: P16152