Recombinant Human CASR Protein, His tagged

Cat.No. : CASR-49H
Product Overview : Recombinant Human CASR Protein with His tag was expressed in E. coli.
Availability March 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a plasma membrane G protein-coupled receptor that senses small changes in circulating calcium concentration. The encoded protein couples this information to intracellular signaling pathways that modify parathyroid hormone secretion or renal cation handling, and thus this protein plays an essential role in maintaining mineral ion homeostasis. Mutations in this gene are a cause of familial hypocalciuric hypercalcemia, neonatal severe hyperparathyroidism, and autosomal dominant hypocalcemia.
Molecular Mass : The protein has a calculated MW of 67 kDa.
AA Sequence : MGSSHHHHHHSSGLVPRGSHMYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAK
Purity : > 95% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.62 mg/mL
Storage Buffer : Sterile 20 mM Tris, 100 mM NaCl, 5 mM EDTA, pH 8.0
Gene Name CASR calcium-sensing receptor [ Homo sapiens ]
Official Symbol CASR
Synonyms CASR; calcium-sensing receptor; HHC, HHC1, hypocalciuric hypercalcemia 1; extracellular calcium-sensing receptor; FHH; GPRC2A; NSHPT; severe neonatal hyperparathyroidism; parathyroid Ca(2+)-sensing receptor 1; parathyroid cell calcium-sensing receptor; CAR; FIH; HHC; EIG8; HHC1; PCAR1; MGC138441;
Gene ID 846
mRNA Refseq NM_000388
Protein Refseq NP_000379
MIM 601199
UniProt ID P41180

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CASR Products

Required fields are marked with *

My Review for All CASR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon