Recombinant Human CASP6 protein(59-222 aa), His-tagged

• Cat.No.: CASP6-10735H
• Product Overview: Recombinant Human CASP6 protein(59-222 aa), fused with His tag, was expressed in E. coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 59-222 aa
• AA Sequence: LTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRET
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: CASP6 caspase 6, apoptosis-related cysteine peptidase [ Homo sapiens ]
• Official Symbol: CASP6
• Synonyms: CASP6; caspase 6, apoptosis-related cysteine peptidase; caspase 6, apoptosis related cysteine protease; caspase-6; MCH2; apoptotic protease MCH-2; caspase 6, apoptosis-related cysteine protease
• Gene ID: 839
• mRNA Refseq: NM_001226
• Protein Refseq: NP_001217
• MIM: 601532
• UniProt ID: P55212

Reviews

08/08/2024

CASP6-10735H

The CASP6 worked for our application