Recombinant Human CASP2 Protein, GST-Tagged

Cat.No. : CASP2-0419H
Product Overview : Human CASP2 full-length ORF (AAH02427.2, 1 a.a. - 452 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Caspases mediate cellular apoptosis through the proteolytic cleavage of specific protein substrates. The encoded protein may function in stress-induced cell death pathways, cell cycle maintenance, and the suppression of tumorigenesis. Increased expression of this gene may play a role in neurodegenerative disorders including Alzheimer's disease, Huntington's disease and temporal lobe epilepsy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]
Molecular Mass : 77.1 kDa
AA Sequence : MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CASP2 caspase 2, apoptosis-related cysteine peptidase [ Homo sapiens ]
Official Symbol CASP2
Synonyms CASP2; caspase 2, apoptosis-related cysteine peptidase; NEDD2, neural precursor cell expressed, developmentally down regulated 2; caspase-2; ICH1; PPP1R57; protein phosphatase 1; regulatory subunit 57; protease ICH-1; protein phosphatase 1, regulatory subunit 57; neural precursor cell expressed developmentally down-regulated protein 2; NEDD2; CASP-2; NEDD-2;
Gene ID 835
mRNA Refseq NM_001224
Protein Refseq NP_001215
MIM 600639
UniProt ID P42575

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CASP2 Products

Required fields are marked with *

My Review for All CASP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon