Recombinant Human CASP2 Protein, GST-Tagged
Cat.No. : | CASP2-0419H |
Product Overview : | Human CASP2 full-length ORF (AAH02427.2, 1 a.a. - 452 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Caspases mediate cellular apoptosis through the proteolytic cleavage of specific protein substrates. The encoded protein may function in stress-induced cell death pathways, cell cycle maintenance, and the suppression of tumorigenesis. Increased expression of this gene may play a role in neurodegenerative disorders including Alzheimer's disease, Huntington's disease and temporal lobe epilepsy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011] |
Molecular Mass : | 77.1 kDa |
AA Sequence : | MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CASP2 caspase 2, apoptosis-related cysteine peptidase [ Homo sapiens ] |
Official Symbol | CASP2 |
Synonyms | CASP2; caspase 2, apoptosis-related cysteine peptidase; NEDD2, neural precursor cell expressed, developmentally down regulated 2; caspase-2; ICH1; PPP1R57; protein phosphatase 1; regulatory subunit 57; protease ICH-1; protein phosphatase 1, regulatory subunit 57; neural precursor cell expressed developmentally down-regulated protein 2; NEDD2; CASP-2; NEDD-2; |
Gene ID | 835 |
mRNA Refseq | NM_001224 |
Protein Refseq | NP_001215 |
MIM | 600639 |
UniProt ID | P42575 |
◆ Recombinant Proteins | ||
CASP2-2926HF | Recombinant Full Length Human CASP2 Protein, GST-tagged | +Inquiry |
CASP2-2593H | Recombinant Human CASP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CASP2-0419H | Recombinant Human CASP2 Protein, GST-Tagged | +Inquiry |
CASP2-802R | Recombinant Rat CASP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CASP2-195H | Recombinant Human CASP2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP2-285HCL | Recombinant Human CASP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CASP2 Products
Required fields are marked with *
My Review for All CASP2 Products
Required fields are marked with *
0
Inquiry Basket