Recombinant Human CARM1 Protein, GST-Tagged

• Cat.No.: CARM1-0402H
• Product Overview: Human CARM1 partial ORF (NP_954592, 284 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated proteins and is involved in regulation of gene expression. The enzyme may act in association with other proteins or within multi-protein complexes and may play a role in cell type-specific functions and cell lineage specification. A related pseudogene is located on chromosome 9. [provided by RefSeq, Aug 2013]
• Molecular Mass: 36.52 kDa
• AA Sequence: NMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CARM1 coactivator-associated arginine methyltransferase 1 [ Homo sapiens ]
• Official Symbol: CARM1
• Synonyms: CARM1; coactivator-associated arginine methyltransferase 1; histone-arginine methyltransferase CARM1; PRMT4; protein arginine N-methyltransferase 4
• Gene ID: 10498
• mRNA Refseq: NM_199141
• Protein Refseq: NP_954592
• MIM: 603934
• UniProt ID: Q86X55