Recombinant Human CARM1 Protein, GST-Tagged
Cat.No. : | CARM1-0402H |
Product Overview : | Human CARM1 partial ORF (NP_954592, 284 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated proteins and is involved in regulation of gene expression. The enzyme may act in association with other proteins or within multi-protein complexes and may play a role in cell type-specific functions and cell lineage specification. A related pseudogene is located on chromosome 9. [provided by RefSeq, Aug 2013] |
Molecular Mass : | 36.52 kDa |
AA Sequence : | NMFPTIGDVHLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CARM1 coactivator-associated arginine methyltransferase 1 [ Homo sapiens ] |
Official Symbol | CARM1 |
Synonyms | CARM1; coactivator-associated arginine methyltransferase 1; histone-arginine methyltransferase CARM1; PRMT4; protein arginine N-methyltransferase 4; |
Gene ID | 10498 |
mRNA Refseq | NM_199141 |
Protein Refseq | NP_954592 |
MIM | 603934 |
UniProt ID | Q86X55 |
◆ Recombinant Proteins | ||
CARM1-999H | Recombinant Human CARM1, Flag-tagged | +Inquiry |
CARM1-617H | Recombinant Human CARM1, His-tagged | +Inquiry |
CARM1-451H | Recombinant Human CARM1 | +Inquiry |
CARM1-003H | Recombinant Human CARM1 Protein, GST-tagged | +Inquiry |
CARM1-2735M | Recombinant Mouse CARM1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CARM1-7846HCL | Recombinant Human CARM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CARM1 Products
Required fields are marked with *
My Review for All CARM1 Products
Required fields are marked with *
0
Inquiry Basket