Recombinant Human CARHSP1, His-tagged

Cat.No. : CARHSP1-26810TH
Product Overview : Recombinant fragment, corresponding to amino acids 26-147 of Human CARHSP1 with N terminal His tag; Predicted MWt 14 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 26-147 a.a.
Description : CARHSP1 is a serine phosphoprotein originally identified as a physiological substrate for the Ca2+-calmodulin regulated protein phosphatase calcineurin (PP2B).
Conjugation : HIS
Form : Lyophilised:Reconstitute with 73 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SRERSPSPLRGNVVPSPLPTRRTRTFSATVRASQGPVYKG VCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVE GDEVTYKMCSIPPKNEKLQAVEVVITHLAPGTKHETWS GHVISS
Sequence Similarities : Contains 1 CSD (cold-shock) domain.
Gene Name CARHSP1 calcium regulated heat stable protein 1, 24kDa [ Homo sapiens ]
Official Symbol CARHSP1
Synonyms CARHSP1; calcium regulated heat stable protein 1, 24kDa; calcium regulated heat stable protein 1 (24kD); calcium-regulated heat stable protein 1; CRHSP 24; CSDC1;
Gene ID 23589
mRNA Refseq NM_001042476
Protein Refseq NP_001035941
Uniprot ID Q9Y2V2
Chromosome Location 16p13.2
Function DNA binding; RNA binding; mRNA 3-UTR binding; phosphatase binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CARHSP1 Products

Required fields are marked with *

My Review for All CARHSP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon