Recombinant Human CARD19 Protein, GST-Tagged

• Cat.No.: CARD19 -0218H
• Product Overview: Human CARD19 full-length ORF (NP_115686.3, 1 a.a. - 183 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CARD19 (Caspase Recruitment Domain Family Member 19) is a Protein Coding gene.
• Molecular Mass: 47 kDa
• AA Sequence: MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQNSDCTELDSGSQSGELSNRGPMSFLAGLGLAVGLALLLYCYPPDPKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLGGL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CARD19 caspase recruitment domain family member 19 [ Homo sapiens (human) ]
• Official Symbol: CARD19
• Synonyms: CARD19; caspase recruitment domain family member 19; C9ORF89; chromosome 9 open reading frame 89; bcl10-interacting CARD protein; bA370F5.1; Bcl10 interacting protein with CARD; BinCARD; MGC11115; Bcl10-interacting protein with CARD; MGC110898
• Gene ID: 84270
• mRNA Refseq: NM_032310
• Protein Refseq: NP_115686
• UniProt ID: Q96LW7