Recombinant Human CARD17 protein(1-110aa), His&Myc-tagged

• Cat.No.: CARD17-2861H
• Product Overview: Recombinant Human CARD17 protein(Q5XLA6)(1-110aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 1-110aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 19.3 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS

Gene Information

• Gene Name: CARD17 caspase recruitment domain family, member 17 [ Homo sapiens ]
• Official Symbol: CARD17
• Synonyms: CARD17; caspase recruitment domain family, member 17; caspase recruitment domain-containing protein 17; INCA; Inhibitory CARD; caspase-1 inhibitor INCA; inhibitory caspase recruitment domain protein; inhibitory caspase recruitment domain (CARD) protein
• Gene ID: 440068
• mRNA Refseq: NM_001007232
• Protein Refseq: NP_001007233
• MIM: 609490
• UniProt ID: Q5XLA6