Recombinant Full Length Human CARD17 Protein, GST-tagged

• Cat.No.: CARD17-5869HF
• Product Overview: Human INCA full-length ORF ( NP_001007233.1, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 110 amino acids
• Description: CARD17 (Caspase Recruitment Domain Family Member 17) is a Protein Coding gene. Among its related pathways are Toll-Like receptor Signaling Pathways. GO annotations related to this gene include cysteine-type endopeptidase inhibitor activity. An important paralog of this gene is CARD16.
• Molecular Mass: 38.3 kDa
• AA Sequence: MADKVLKEKRKQFIRSVGEGTINGLLGELLETRVLSQEEIEIVKCENATVMDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLTTQDSQIVLPS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CARD17 caspase recruitment domain family, member 17 [ Homo sapiens ]
• Official Symbol: CARD17
• Synonyms: CARD17; caspase recruitment domain family, member 17; caspase recruitment domain-containing protein 17; INCA; Inhibitory CARD; caspase-1 inhibitor INCA; inhibitory caspase recruitment domain protein; inhibitory caspase recruitment domain (CARD) protein
• Gene ID: 440068
• mRNA Refseq: NM_001007232
• Protein Refseq: NP_001007233
• MIM: 609490
• UniProt ID: Q5XLA6