Recombinant Human CAPN15 Protein, GST-tagged

• Cat.No.: CAPN15-38H
• Product Overview: Recombinant Human CAPN15(993 a.a. - 1086 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 993 a.a. - 1086 a.a.
• Description: This gene encodes a protein containing zinc-finger-like repeats and a calpain-like protease domain. The encoded protein may function as a transcription factor, RNA-binding protein, or in protein-protein interactions during visual system development.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.08 kDa
• AA Sequence: HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL
• Applications: Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: CAPN15 calpain 15 [ Homo sapiens ]
• Official Symbol: CAPN15
• Synonyms: SOLH
• Gene ID: 6650
• mRNA Refseq: NM_005632
• Protein Refseq: NP_005623
• MIM: 603267
• UniProt ID: O75808