Recombinant Human CAPN13 Protein, GST-tagged

• Cat.No.: CAPN13-309H
• Product Overview: Recombinant Human CAPN13(570 a.a. - 668 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 570 a.a. - 668 a.a.
• Description: The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes a member of the calpain large subunit family.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.63 kDa
• AA Sequence: LVHYQHVFQKVQTSPGVLLSSDLWKAIENTDFLRGIFISRELLHLVTLRYSDSVGRVSFPSLVCFLMRLEAMAKTFRNLSKDGKGLYLTEMEWMSLVMY
• Applications: Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: CAPN13 calpain 13 [ Homo sapiens ]
• Official Symbol: CAPN13
• Synonyms: CANP 13; calcium-activated neutral proteinase 13
• Gene ID: 92291
• mRNA Refseq: NM_144575
• Protein Refseq: NP_653176
• MIM: 610228
• UniProt ID: Q6MZZ7