Recombinant Human CAPN1 Protein, GST-Tagged

• Cat.No.: CAPN1-0355H
• Product Overview: Human CAPN1 partial ORF (AAH08751, 610 a.a. - 714 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]
• Molecular Mass: 37.18 kDa
• AA Sequence: FNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELIITRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CAPN1 calpain 1, (mu/I) large subunit [ Homo sapiens ]
• Official Symbol: CAPN1
• Synonyms: CAPN1; calpain 1, (mu/I) large subunit; calpain-1 catalytic subunit; CANP; CANPL1; muCANP; muCL; CANP 1; calpain mu-type; micromolar-calpain; calpain-1 large subunit; calpain, large polypeptide L1; calcium-activated neutral proteinase 1; cell proliferation-inducing protein 30; cell proliferation-inducing gene 30 protein; CANP1
• Gene ID: 823
• mRNA Refseq: NM_001198868
• Protein Refseq: NP_001185797
• MIM: 114220
• UniProt ID: P07384