Recombinant Human CALR Protein
Cat.No. : | CALR-06H |
Product Overview : | Recombinant Human CALR Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Calreticulin is a highly conserved chaperone protein which resides primarily in the endoplasmic reticulum, and is involved in a variety of cellular processes, among them, cell adhesion. Additionally, it functions in protein folding quality control and calcium homeostasis. Calreticulin is also found in the nucleus, suggesting that it may have a role in transcription regulation. Systemic lupus erythematosus is associated with increased autoantibody titers against calreticulin. Recurrent mutations in calreticulin have been linked to various neoplasms, including the myeloproliferative type. |
Form : | Liquid. In 20 mM Tris-HCl, 150 mM NaCl, 5 mM CaCl2, pH 8.0, with 10% glycerol. |
Molecular Mass : | ~45 kDa |
AA Sequence : | MSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL |
Endotoxin : | <1 EU/ug as determined by LAL method. |
Purity : | >90% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.17 mg/ml |
Official Full Name : | Calreticulin |
Gene Name | CALR calreticulin [ Homo sapiens (human) ] |
Official Symbol | CALR |
Synonyms | RO; CRT; SSA; cC1qR; HEL-S-99n |
Gene ID | 811 |
mRNA Refseq | NM_004343 |
Protein Refseq | NP_004334 |
MIM | 109091 |
UniProt ID | P27797 |
◆ Recombinant Proteins | ||
CALR-2368H | Recombinant Human Calreticulin, 18-417 aa, His-tagged | +Inquiry |
CALR-906H | Recombinant Human Calreticulin, His-tagged | +Inquiry |
CALR-27212TH | Recombinant Human CALR, His-tagged | +Inquiry |
CALR-001H | Recombinant Human calreticulin Protein, His-tagged | +Inquiry |
CALR-2625H | Recombinant Human CALR protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CALR-1222HCL | Recombinant Human CALR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CALR Products
Required fields are marked with *
My Review for All CALR Products
Required fields are marked with *
0
Inquiry Basket