Recombinant Human CALCB protein, GST-tagged

Cat.No. : CALCB-2621H
Product Overview : Recombinant Human CALCB protein(P10092)(1-127aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-127aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 40.7 kDa
AA Sequence : MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CALCB calcitonin-related polypeptide beta [ Homo sapiens ]
Official Symbol CALCB
Synonyms CALCB; calcitonin-related polypeptide beta; CALC2, calcitonin 2; calcitonin gene-related peptide 2; CGRP II; FLJ30166; beta-CGRP; calcitonin 2; beta-type CGRP; calcitonin gene-related peptide II; CALC2; CGRP2; CGRP-II;
Gene ID 797
mRNA Refseq NM_000728
Protein Refseq NP_000719
MIM 114160
UniProt ID P10092

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CALCB Products

Required fields are marked with *

My Review for All CALCB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon