Recombinant Human CADM1 protein, His-tagged

• Cat.No.: CADM1-35H
• Product Overview: Recombinant Human CADM1 protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Enables signaling receptor binding activity. Involved in several processes, including cell recognition; positive regulation of cytokine production; and susceptibility to natural killer cell mediated cytotoxicity. Located in plasma membrane. Implicated in breast carcinoma and prostate cancer. Biomarker of cervix uteri carcinoma in situ.
• Form: PBS, pH 7.4.
• Molecular Mass: 35.35 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMDGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPP
• Purity: ＞90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: CADM1 cell adhesion molecule 1 [ Homo sapiens (human) ]
• Official Symbol: CADM1
• Gene ID: 23705
• mRNA Refseq: NM_014333
• Protein Refseq: NP_055148
• MIM: 605686
• UniProt ID: Q9BY67