Recombinant Human CACNG3 Protein, GST-Tagged
Cat.No. : | CACNG3-0276H |
Product Overview : | Human CACNG3 partial ORF (NP_006530, 199 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family. This gene is a susceptibility locus for childhood absence epilepsy. [provided by RefSeq, Dec 2010] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | IYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CACNG3 calcium channel, voltage-dependent, gamma subunit 3 [ Homo sapiens ] |
Official Symbol | CACNG3 |
Synonyms | CACNG3; calcium channel, voltage-dependent, gamma subunit 3; voltage-dependent calcium channel gamma-3 subunit; TARP gamma-3; voltage-gated calcium channel gamma subunit; transmembrane AMPAR regulatory protein gamma-3; neuronal voltage-gated calcium channel gamma-3 subunit; |
Gene ID | 10368 |
mRNA Refseq | NM_006539 |
Protein Refseq | NP_006530 |
MIM | 606403 |
UniProt ID | O60359 |
◆ Cell & Tissue Lysates | ||
CACNG3-270HCL | Recombinant Human CACNG3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CACNG3 Products
Required fields are marked with *
My Review for All CACNG3 Products
Required fields are marked with *
0
Inquiry Basket