Recombinant Human CACNG3 Protein, GST-Tagged

• Cat.No.: CACNG3-0276H
• Product Overview: Human CACNG3 partial ORF (NP_006530, 199 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family. This gene is a susceptibility locus for childhood absence epilepsy. [provided by RefSeq, Dec 2010]
• Molecular Mass: 36.63 kDa
• AA Sequence: IYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CACNG3 calcium channel, voltage-dependent, gamma subunit 3 [ Homo sapiens ]
• Official Symbol: CACNG3
• Synonyms: CACNG3; calcium channel, voltage-dependent, gamma subunit 3; voltage-dependent calcium channel gamma-3 subunit; TARP gamma-3; voltage-gated calcium channel gamma subunit; transmembrane AMPAR regulatory protein gamma-3; neuronal voltage-gated calcium channel gamma-3 subunit
• Gene ID: 10368
• mRNA Refseq: NM_006539
• Protein Refseq: NP_006530
• MIM: 606403
• UniProt ID: O60359