Recombinant Human CACNB1, His-tagged

Cat.No. : CACNB1-26767TH
Product Overview : Recombinant fragment, corresponding to amino acids 395-598 of Human CACNB1 with N terminal His tag; 204 amino acids, 34kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 395-598 a.a.
Description : The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified.
Conjugation : HIS
Tissue specificity : Isoform 1 and isoform 3 are expressed in brain, heart, spleen, central nervous system and neuroblastoma cells. Isoform 2 is expressed in skeletal muscle.
Form : Lyophilised:Reconstitute with 62 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EDACEHLAEYLEAYWKATHPPSSTPPNPLLNRTMATAALA ASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGEL GQPPGLYPSSHPPGRAGTLRALSRQDTFDADTPGSRNSAY TELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWED EEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNEL EGWGRGVYIR
Sequence Similarities : Belongs to the calcium channel beta subunit family.Contains 1 SH3 domain.
Gene Name CACNB1 calcium channel, voltage-dependent, beta 1 subunit [ Homo sapiens ]
Official Symbol CACNB1
Synonyms CACNB1; calcium channel, voltage-dependent, beta 1 subunit; CACNLB1; voltage-dependent L-type calcium channel subunit beta-1;
Gene ID 782
mRNA Refseq NM_000723
Protein Refseq NP_000714
MIM 114207
Uniprot ID Q02641
Chromosome Location 17q21-q22
Pathway Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Axon guidance, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem;
Function high voltage-gated calcium channel activity; voltage-gated calcium channel activity; voltage-gated ion channel activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CACNB1 Products

Required fields are marked with *

My Review for All CACNB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon