Recombinant Human CACNB1, His-tagged
Cat.No. : | CACNB1-26767TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 395-598 of Human CACNB1 with N terminal His tag; 204 amino acids, 34kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 395-598 a.a. |
Description : | The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. |
Conjugation : | HIS |
Tissue specificity : | Isoform 1 and isoform 3 are expressed in brain, heart, spleen, central nervous system and neuroblastoma cells. Isoform 2 is expressed in skeletal muscle. |
Form : | Lyophilised:Reconstitute with 62 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EDACEHLAEYLEAYWKATHPPSSTPPNPLLNRTMATAALA ASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGEL GQPPGLYPSSHPPGRAGTLRALSRQDTFDADTPGSRNSAY TELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWED EEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNEL EGWGRGVYIR |
Sequence Similarities : | Belongs to the calcium channel beta subunit family.Contains 1 SH3 domain. |
Gene Name | CACNB1 calcium channel, voltage-dependent, beta 1 subunit [ Homo sapiens ] |
Official Symbol | CACNB1 |
Synonyms | CACNB1; calcium channel, voltage-dependent, beta 1 subunit; CACNLB1; voltage-dependent L-type calcium channel subunit beta-1; |
Gene ID | 782 |
mRNA Refseq | NM_000723 |
Protein Refseq | NP_000714 |
MIM | 114207 |
Uniprot ID | Q02641 |
Chromosome Location | 17q21-q22 |
Pathway | Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Axon guidance, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cardiac muscle contraction, organism-specific biosystem; |
Function | high voltage-gated calcium channel activity; voltage-gated calcium channel activity; voltage-gated ion channel activity; |
◆ Recombinant Proteins | ||
CACNB1-6188H | Recombinant Human CACNB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CACNB1-762Z | Recombinant Zebrafish CACNB1 | +Inquiry |
Cacnb1-736M | Recombinant Mouse Cacnb1 Protein, MYC/DDK-tagged | +Inquiry |
CACNB1-26767TH | Recombinant Human CACNB1, His-tagged | +Inquiry |
CACNB1-732R | Recombinant Rat CACNB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CACNB1-7903HCL | Recombinant Human CACNB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CACNB1 Products
Required fields are marked with *
My Review for All CACNB1 Products
Required fields are marked with *
0
Inquiry Basket