Recombinant Human CACNA2D2 Protein, GST-Tagged

• Cat.No.: CACNA2D2-0269H
• Product Overview: Human CACNA2D2 partial ORF (NP_006021, 65 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Calcium channels mediate the entry of calcium ions into the cell upon membrane polarization. This gene encodes the alpha-2/delta subunit of the voltage-dependent calcium channel complex. The complex consists of the main channel-forming subunit alpha-1, and auxiliary subunits alpha-2/delta, beta, and gamma. The auxiliary subunits function in the assembly and membrane localization of the complex, and modulate calcium currents and channel activation/inactivation kinetics. The subunit encoded by this gene undergoes post-translational cleavage to yield the extracellular alpha2 peptide and a membrane-anchored delta polypeptide. This subunit is a receptor for the antiepileptic drug, gabapentin. Mutations in this gene are associated with early infantile epileptic encephalopathy. Single nucleotide polymorphisms in this gene are correlated with increased sensitivity to opioid drugs. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014]
• Molecular Mass: 36.52 kDa
• AA Sequence: PQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CACNA2D2 calcium channel, voltage-dependent, alpha 2/delta subunit 2 [ Homo sapiens ]
• Official Symbol: CACNA2D2
• Synonyms: CACNA2D2; calcium channel, voltage-dependent, alpha 2/delta subunit 2; voltage-dependent calcium channel subunit alpha-2/delta-2; gene 26; KIAA0558; alpha 2 delta calcium channel subunit; voltage-gated calcium channel subunit alpha-2/delta-2; CACNA2D; LUAC11.1
• Gene ID: 9254
• mRNA Refseq: NM_001005505
• Protein Refseq: NP_001005505
• MIM: 607082
• UniProt ID: Q9NY47