Recombinant Human CACNA1I Protein, GST-Tagged

• Cat.No.: CACNA1I-0267H
• Product Overview: Human CACNA1I partial ORF (NP_066919, 233 a.a. - 331 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes the pore-forming alpha subunit of a voltage gated calcium channel. The encoded protein is a member of a subfamily of calcium channels referred to as is a low voltage-activated, T-type, calcium channel. The channel encoded by this protein is characterized by a slower activation and inactivation compared to other T-type calcium channels. This protein may be involved in calcium signaling in neurons. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2011]
• Molecular Mass: 36.63 kDa
• AA Sequence: GLLRNRCFLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CACNA1I calcium channel, voltage-dependent, T type, alpha 1I subunit [ Homo sapiens ]
• Official Symbol: CACNA1I
• Synonyms: CACNA1I; calcium channel, voltage-dependent, T type, alpha 1I subunit; voltage-dependent T-type calcium channel subunit alpha-1I; Cav3.3; voltage-gated calcium channel subunit alpha Cav3.3; calcium channel, voltage-dependent, alpha 1I subunit; ca(v)3.3; KIAA1120
• Gene ID: 8911
• mRNA Refseq: NM_001003406
• Protein Refseq: NP_001003406
• MIM: 608230
• UniProt ID: Q9P0X4