Recombinant Human CACNA1G protein, His-tagged

• Cat.No.: CACNA1G-10635H
• Product Overview: Recombinant Human CACNA1G protein(O43497)(Arg1161-Ile1240), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Arg1161-Ile1240
• Tag: C-His
• Form: Phosphate buffered saline.
• Molecular Mass: 11 kDa
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: RGSLEREAKSSFDLPDTLQVPGLHRTASGRGSASEHQDCNGKSASGRLARALRPDDPPLDGDDADDEGNLSKGERVRAWI

Gene Information

• Gene Name: CACNA1G calcium channel, voltage-dependent, T type, alpha 1G subunit [ Homo sapiens ]
• Official Symbol: CACNA1G
• Synonyms: calcium channel voltage dependent alpha 1G subunit; calcium channel voltage dependent T type alpha 1G subunit; calcium channel voltage dependent T type alpha1G subunit; CaV T1; Cav3 1; cav3 1c; KIAA1123; MGC117234; NBR13; voltage dependent calcium channel alpha 1G subunit isoform 11; voltage dependent T type calcium channel subunit alpha 1G; Voltage gated calcium channel subunit alpha Cav3 1; CACNA1G
• Gene ID: 8913
• mRNA Refseq: NM_018896.4
• Protein Refseq: NP_061496.2
• MIM: 604065
• UniProt ID: O43497