Recombinant Human CACNA1G protein, His-tagged
Cat.No. : | CACNA1G-10635H |
Product Overview : | Recombinant Human CACNA1G protein(O43497)(Arg1161-Ile1240), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Arg1161-Ile1240 |
Tag : | C-His |
Form : | Phosphate buffered saline. |
Molecular Mass : | 11 kDa |
Storage : | Store at -20°C to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | RGSLEREAKSSFDLPDTLQVPGLHRTASGRGSASEHQDCNGKSASGRLARALRPDDPPLDGDDADDEGNLSKGERVRAWI |
Gene Name | CACNA1G calcium channel, voltage-dependent, T type, alpha 1G subunit [ Homo sapiens ] |
Official Symbol | CACNA1G |
Synonyms | calcium channel voltage dependent alpha 1G subunit; calcium channel voltage dependent T type alpha 1G subunit; calcium channel voltage dependent T type alpha1G subunit; CaV T1; Cav3 1; cav3 1c; KIAA1123; MGC117234; NBR13; voltage dependent calcium channel alpha 1G subunit isoform 11; voltage dependent T type calcium channel subunit alpha 1G; Voltage gated calcium channel subunit alpha Cav3 1; CACNA1G |
Gene ID | 8913 |
mRNA Refseq | NM_018896.4 |
Protein Refseq | NP_061496.2 |
MIM | 604065 |
UniProt ID | O43497 |
◆ Recombinant Proteins | ||
CACNA1G-10634H | Recombinant Human CACNA1G, His-tagged | +Inquiry |
CACNA1G-727R | Recombinant Rat CACNA1G Protein, His (Fc)-Avi-tagged | +Inquiry |
CACNA1G-10635H | Recombinant Human CACNA1G protein, His-tagged | +Inquiry |
CACNA1G-1063R | Recombinant Rat CACNA1G Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CACNA1G Products
Required fields are marked with *
My Review for All CACNA1G Products
Required fields are marked with *
0
Inquiry Basket