Name: Recombinant Human CACNA1F Protein, GST-Tagged
SKU: CACNA1F-0266H

Species :	Human
Source :	Wheat Germ
Tag :	GST
Description :	This gene encodes a multipass transmembrane protein that functions as an alpha-1 subunit of the voltage-dependent calcium channel, which mediates the influx of calcium ions into the cell. The encoded protein forms a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Mutations in this gene can cause X-linked eye disorders, including congenital stationary night blindness type 2A, cone-rod dystropy, and Aland Island eye disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Aug 2013]
Molecular Mass :	36.74 kDa
AA Sequence :	LHVPGTHSDPSHGKRGSADSLVEAVLISEGLGLFARDPRFVALAKQEIADACRLTLDEMDNAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	CACNA1F calcium channel, voltage-dependent, L type, alpha 1F subunit [ Homo sapiens ]
Official Symbol	CACNA1F
Synonyms	CACNA1F; calcium channel, voltage-dependent, L type, alpha 1F subunit; AIED, Aland island eye disease (Forsius Eriksson ocular albinism, ocular albinism type 2), CSNB2; voltage-dependent L-type calcium channel subunit alpha-1F; Cav1.4; COD4; CORDX3; CSNB2A; CSNBX2; JM8; JMC8; OA2; Cav1.4alpha1; voltage gated calcium channel alpha 1F subunit; voltage-gated calcium channel subunit alpha Cav1.4; Aland island eye disease (Forsius-Eriksson ocular albinism, ocular albinism type 2); AIED; COD3; CORDX; CSNB2;
Gene ID	778
mRNA Refseq	NM_001256789
Protein Refseq	NP_001243718
MIM	300110
UniProt ID	O60840