Recombinant Human CACNA1D protein, His-tagged
Cat.No. : | CACNA1D-353H |
Product Overview : | Recombinant Human CACNA1D protein(Q01668)(Lys1561-Val1780), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Lys1561-Val1780 |
Tag : | C-His |
Form : | Phosphate buffered saline. |
Molecular Mass : | 26 kDa |
Storage : | Store at -20°C to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIALQAGLRTLHDIGPEIRRAISCDLQDDEPEETKREEEDDVFKRNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHNHHNHNSIGKQVPTSTNANLNNANMSKAAHGKRPSIGNLEHV |
Gene Name | CACNA1D calcium channel, voltage-dependent, L type, alpha 1D subunit [ Homo sapiens ] |
Official Symbol | CACNA1D |
Synonyms | CACH3; CACN4; Cav1.3; CCHL1A2; CACNL1A2 |
Gene ID | 776 |
mRNA Refseq | NM_001128840.1 |
Protein Refseq | NP_001122312.1 |
MIM | 114206 |
UniProt ID | Q01668 |
◆ Recombinant Proteins | ||
CACNA1D-1062R | Recombinant Rat CACNA1D Protein | +Inquiry |
CACNA1D-353H | Recombinant Human CACNA1D protein, His-tagged | +Inquiry |
CACNA1D-6591C | Recombinant Chicken CACNA1D | +Inquiry |
CACNA1D-726R | Recombinant Rat CACNA1D Protein, His (Fc)-Avi-tagged | +Inquiry |
CACNA1D-0466H | Recombinant Human CACNA1D Protein (Met1-Lys163), N-His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CACNA1D Products
Required fields are marked with *
My Review for All CACNA1D Products
Required fields are marked with *
0
Inquiry Basket