Recombinant Human CACNA1A protein, GST-tagged

Cat.No. : CACNA1A-301352H
Product Overview : Recombinant Human CACNA1A (821-920 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met821-Glu920
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MDRPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGPYGRESDHHAREGSLEQPGFWEGE
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name CACNA1A calcium channel, voltage-dependent, P/Q type, alpha 1A subunit [ Homo sapiens ]
Official Symbol CACNA1A
Synonyms CACNA1A; calcium channel, voltage-dependent, P/Q type, alpha 1A subunit; CACNL1A4, MHP, MHP1, SCA6; voltage-dependent P/Q-type calcium channel subunit alpha-1A; APCA; Cav2.1; EA2; FHM; HPCA; brain calcium channel 1; brain calcium channel I; calcium channel, L type, alpha-1 polypeptide; voltage-gated calcium channel subunit alpha Cav2.1; BI; MHP; MHP1; SCA6; CAV2.1; CACNL1A4;
Gene ID 773
mRNA Refseq NM_000068
Protein Refseq NP_000059
MIM 601011
UniProt ID O00555

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CACNA1A Products

Required fields are marked with *

My Review for All CACNA1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon