Recombinant Human CACNA1A protein, GST-tagged

• Cat.No.: CACNA1A-301352H
• Product Overview: Recombinant Human CACNA1A (821-920 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met821-Glu920
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MDRPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGPYGRESDHHAREGSLEQPGFWEGE
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: CACNA1A calcium channel, voltage-dependent, P/Q type, alpha 1A subunit [ Homo sapiens ]
• Official Symbol: CACNA1A
• Synonyms: CACNA1A; calcium channel, voltage-dependent, P/Q type, alpha 1A subunit; CACNL1A4, MHP, MHP1, SCA6; voltage-dependent P/Q-type calcium channel subunit alpha-1A; APCA; Cav2.1; EA2; FHM; HPCA; brain calcium channel 1; brain calcium channel I; calcium channel, L type, alpha-1 polypeptide; voltage-gated calcium channel subunit alpha Cav2.1; BI; MHP; MHP1; SCA6; CAV2.1; CACNL1A4
• Gene ID: 773
• mRNA Refseq: NM_000068
• Protein Refseq: NP_000059
• MIM: 601011
• UniProt ID: O00555