Recombinant Human CABLES2 Protein, GST-Tagged

• Cat.No.: CABLES2-0257H
• Product Overview: Human CABLES2 partial ORF (NP_112492, 131 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CABLES2 (Cdk5 And Abl Enzyme Substrate 2) is a Protein Coding gene. Among its related pathways are Factors involved in megakaryocyte development and platelet production and Response to elevated platelet cytosolic Ca2+. GO annotations related to this gene include cyclin-dependent protein serine/threonine kinase regulator activity. An important paralog of this gene is CABLES1.
• Molecular Mass: 37.73 kDa
• AA Sequence: LEFLEDAVGCAPAQRTKHTSGSPRHKGLKKTHFIKNMRQYDTRNSRIVLICAKRSLCAAFSVLPYGEGLRISDLRVDSQKQRHPSGGVSVSSEMVFELEGVELGADGKV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CABLES2 Cdk5 and Abl enzyme substrate 2 [ Homo sapiens ]
• Official Symbol: CABLES2
• Synonyms: CABLES2; Cdk5 and Abl enzyme substrate 2; C20orf150, chromosome 20 open reading frame 150; CDK5 and ABL1 enzyme substrate 2; dJ908M14.2; ik3 2; interactor with CDK3 2; ik3-2; C20orf150
• Gene ID: 81928
• mRNA Refseq: NM_031215
• Protein Refseq: NP_112492
• UniProt ID: Q9BTV7