Recombinant Human CA6

• Cat.No.: CA6-26443TH
• Product Overview: Recombinant fragment of Human CA6 with a N terminal proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Description: The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown.
• Protein length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Major constituent of saliva.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN
• Sequence Similarities: Belongs to the alpha-carbonic anhydrase family.
• Tag: Non

Gene Information

• Gene Name: CA6 carbonic anhydrase VI [ Homo sapiens ]
• Official Symbol: CA6
• Synonyms: CA6; carbonic anhydrase VI; carbonic anhydrase 6
• Gene ID: 765
• mRNA Refseq: NM_001215
• Protein Refseq: NP_001206
• MIM: 114780
• Uniprot ID: P23280
• Chromosome Location: 1p36.2
• Pathway: Nitrogen metabolism, organism-specific biosystem; Nitrogen metabolism, conserved biosystem
• Function: carbonate dehydratase activity; lyase activity; metal ion binding; zinc ion binding