Recombinant Human CA5A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CA5A-2562H |
Product Overview : | CA5A MS Standard C13 and N15-labeled recombinant protein (NP_001730) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VA is localized in the mitochondria and expressed primarily in the liver. It may play an important role in ureagenesis and gluconeogenesis. CA5A gene maps to chromosome 16q24.3 and an unprocessed pseudogene has been assigned to 16p12-p11.2. |
Molecular Mass : | 34.75 kDa |
AA Sequence : | MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRSSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CA5A carbonic anhydrase 5A [ Homo sapiens (human) ] |
Official Symbol | CA5A |
Synonyms | CA5A; carbonic anhydrase VA, mitochondrial; CA5; carbonic anhydrase 5A, mitochondrial; CAV; CAVA; CA-VA; carbonic dehydratase; carbonate dehydratase VA; carbonic anhydrase V, mitochondrial; |
Gene ID | 763 |
mRNA Refseq | NM_001739 |
Protein Refseq | NP_001730 |
MIM | 114761 |
UniProt ID | P35218 |
◆ Recombinant Proteins | ||
CA5A-2269H | Recombinant Human CA5A Protein, MYC/DDK-tagged | +Inquiry |
Car5a-768M | Recombinant Mouse Car5a Protein, MYC/DDK-tagged | +Inquiry |
CA5A-2562H | Recombinant Human CA5A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CA5A-8564H | Recombinant Human CA5A protein | +Inquiry |
CA5a-1160M | Recombinant Mouse CA5a Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CA5A Products
Required fields are marked with *
My Review for All CA5A Products
Required fields are marked with *
0
Inquiry Basket