Recombinant Human CA2 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: CA2-201H
• Product Overview: CA2 MS Standard C13 and N15-labeled recombinant protein (NP_000058) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is one of several isozymes of carbonic anhydrase, which catalyzes reversible hydration of carbon dioxide. Defects in this enzyme are associated with osteopetrosis and renal tubular acidosis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2014]
• Molecular Mass: 29.2 kDa
• AA Sequence: MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFAARGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CA2 carbonic anhydrase II [ Homo sapiens (human) ]
• Official Symbol: CA2
• Synonyms: CA2; carbonic anhydrase II; carbonic anhydrase 2; CA II; CAII; Car2; CAC; carbonic anhydrase B; carbonic anhydrase C; carbonic dehydratase; carbonate dehydratase II; CA-II
• Gene ID: 760
• mRNA Refseq: NM_000067
• Protein Refseq: NP_000058
• MIM: 611492
• UniProt ID: P00918