Recombinant Human CA1 protein(11-260 aa), C-His-tagged

• Cat.No.: CA1-2503H
• Product Overview: Recombinant Human CA1 protein(P00915)(11-260 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 11-260 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 30 kDa
• AASequence: KNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRAS
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: CA1 carbonic anhydrase I [ Homo sapiens ]
• Official Symbol: CA1
• Synonyms: CA1; carbonic anhydrase I; carbonic anhydrase 1; Car1; carbonic anhydrase B; carbonic dehydratase; carbonate dehydratase I; CAB; CA-I
• Gene ID: 759
• mRNA Refseq: NM_001128829
• Protein Refseq: NP_001122301
• MIM: 114800
• UniProt ID: P00915